DPCstruct | MC18756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 172 ± 20 aa |
| Standard deviation of domain lengths | 20.27 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0727 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N9PCG2 | 300-461 | IWKVQNTRSAAELEAFLSKLRIHQIAHQDDTIDWMLENFPDLFIIYSKKTYQGMFGGSDPISNLEWVNMNIRANHGSLGAAYPPAGM… |
| A0A2E0SJ19 | 6-151 | DQDRIAGWMGEQFPGMFYIVSRSGTAAFRGMYLTGDEALTSKKWVTEHVSSKGPLGALYPLRTATHSNIHNCLKEGDTPSWFFFLPA… |
| A0A7V2V393 | 494-646 | None |
| A0A7L6B492 | 351-493 | None |
| A0A7W4GS63 | 140-320 | None |
| A0A5C5ZA69 | 433-621 | None |
| A0A7X8MA94 | 3-140 | None |
| A0A1I2KTV6 | 7-130 | None |
| B5JCV4 | 527-714 | None |
| A0A5B9W2G0 | 697-869 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.