DPCstruct | MC18754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 96 ± 14 aa |
| Standard deviation of domain lengths | 13.66 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9VBH8 | 1-104 | MNSKRSSFTPSASVIDREYTHQVALPDDICTQDNFTIILEFFLARGWRYFTRNVQAIWPNGKYQSMRLYCFADRASAEAFQAHFGGE… |
| A0A081CRM9 | 1-81 | MTRRKGELTASAIDSGWPYQIALRESLSSGKRWAEMADFCHQKRLMRCERGHSVFFEDEHYNVHCFATKQGAEAFLKKYGG |
| A0A1Q3KPM7 | 2-93 | None |
| A0A7R7T6C3 | 2-86 | None |
| K2MIQ1 | 24-124 | None |
| A0A7L8AUR5 | 1-93 | None |
| A0A1K2I4M1 | 1-96 | None |
| A0A527RK26 | 57-184 | None |
| A0A2W6YN39 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.