DPCstruct | MC18750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 142 ± 25 aa |
| Standard deviation of domain lengths | 24.98 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 93.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L2W0J6 | 4-117 | SGQGGKVVVQGQNILLDKGSSITATGSKGGGEVYIGGGWQGKDSSIRNADKVVMQDGARIDVSATQQGNGGTAVLWSESFTNFRGQI… |
| A0A451A3Y8 | 21-144 | RGGDISLTADTLTLAGAHLHADGATGGGRIRAGGGWQGKDTDLPNARKTRVTASTDLTANAGTSGDGGTVVIWSEETTTFAGAIAAT… |
| A0A6M5XZD0 | 1-116 | None |
| F4EXD2 | 243-426 | None |
| A0A060DK80 | 34-207 | None |
| A0A1Z4HY62 | 564-679 | None |
| A0A6M0GEM1 | 106-266 | None |
| A0A6M0GBP7 | 111-269 | None |
| A0A090D1A8 | 77-251 | None |
| A0A098TKF5 | 25-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.