DPCstruct | MC18748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 129 ± 12 aa |
| Standard deviation of domain lengths | 12.07 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0JAI0 | 7-145 | TGRSWRALVLLAELVVSLLLGAAVWAAWLGWDHSYYYDPVVGAYQGPYRQAQVVACALTVGLLTALLALRWNPVVVAAGITVGFWVV… |
| A0A4R2EDX2 | 2-130 | RQDLLKLCLRMLAALASALVAMAAWAAWLGWDQRRDVHPDGSTTGPYEAWQVIGLVLTLLAAVYWAVSRGHTVSAVLGTTAGLTAAA… |
| G0HB12 | 44-194 | None |
| A0A561U509 | 1-108 | None |
| A0A3R8REG5 | 2-107 | None |
| A0A2A9E8Y1 | 12-137 | None |
| A0A4R1AT91 | 1-129 | None |
| A0A1B1ME88 | 14-139 | None |
| A0A316A0B0 | 117-256 | None |
| A0A4R1CKD2 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.