DPCstruct | MC18746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 143 ± 6 aa |
| Standard deviation of domain lengths | 6.01 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661P8U9 | 111-251 | TISIEQYATISAELAECSTTERRTGVMESHGFDDDRWTIEERGWLELMAQGALDGDARLAAVYSAHFVRAQDELGSEKEAKRSFDEY… |
| A0A150S3J5 | 7-144 | GVERYATVAAQLLERRAPRADVLRAHGLSEALFAEIERRWSVAMDDEDRRGGHALRDAYDVAYIKEWEAHRGPFELGDYARLTVAAE… |
| A0A017TFP9 | 539-686 | None |
| A0A850BI84 | 650-794 | None |
| A0A850BEY1 | 791-925 | None |
| A0A017T816 | 993-1147 | None |
| A0A017SUE3 | 7-145 | None |
| A0A150TDF2 | 10-148 | None |
| S4XVV7 | 8-145 | None |
| A0A1L6M322 | 53-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.