DPCstruct | MC18745
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 123 ± 7 aa |
| Standard deviation of domain lengths | 6.62 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150RBD6 | 1-112 | MCVWREGERRCPQGFDERHVFASSVVDDRGCTRCTCNADGVRCAATLTFFDEARCEGPIESVPFDGSCAEDAPSATSLSAEVTATGS… |
| A0A850BLJ9 | 276-394 | GMCIYKDGEQASCPGEPFTEKHVFFEDAQDTRDCSACSCNAPSGGKCSATITVYSDVNCTSNPTPFQAGSCGTLPAANLPVFGRTAS… |
| A0A4P2QLX9 | 1-135 | None |
| A0A0K1ESA9 | 123-249 | None |
| A0A150S5Y8 | 1-122 | None |
| A0A7Y5NX27 | 207-322 | None |
| A0A150PQZ7 | 46-176 | None |
| A0A661NI10 | 267-386 | None |
| A0A4P2PXA1 | 368-494 | None |
| A0A4U1J7X2 | 151-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.