DPCstruct | MC18743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 91 ± 6 aa |
| Standard deviation of domain lengths | 6.37 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 35.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4KQD7 | 434-521 | IELDLNYVASNWNQTTFDLWEEVSSSSFFTTAVQHRALREGSALATKIGQTSVVSNYNTQADNSLCFLQSYWNPTGAYITANTGGGRS |
| A0A317GV79 | 120-208 | HADLDYTARHSDDLCFDPWEEESGRHYYTQLVQSVALQNGAMWVNKAGDTARAERYLLASAKLRDRLDRHWSAQKGHYLSRLDVRNG… |
| A0A7W6N612 | 181-267 | None |
| A0A1R1YRN9 | 134-229 | None |
| K1VP64 | 10-109 | None |
| A0A2N5W6C3 | 128-226 | None |
| A0A0G4MJT3 | 213-292 | None |
| A0A146IDJ1 | 159-242 | None |
| A0A4P2R397 | 1-97 | None |
| A0A5N5Q9H7 | 180-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.