DPCstruct | MC1874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Standard deviation of domain lengths | 13.39 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G9SF03 | 1-81 | MTYESAIQYFVTDHPSDSITKKGAIIRQIHPQGHHLVQVFLNAQNQLILRPDGKLYGRQLVARELDKELSDTFGDQDLIIV |
| A0A552L633 | 19-126 | TKENMENVFSTFDKMLPEKPEITSEAKYEDIIAWFLSQPRHPDVKCGAIAKRVFGKDNKIAIIQVFLNGEKQVIQKYEGHQYGRKII… |
| A0A0M1JPJ7 | 18-129 | None |
| A0A261KQ27 | 132-245 | None |
| A0A7G8WBG6 | 1-126 | None |
| A0A1L9QWM0 | 23-128 | None |
| A0A516R1V1 | 3-92 | None |
| U9VWS4 | 29-151 | None |
| A0A844G6G2 | 18-131 | None |
| A0A6I8M9Y5 | 8-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.