DPCstruct | MC18739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 115 ± 12 aa |
| Standard deviation of domain lengths | 11.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 24.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19800 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S3AC09 | 1-116 | MTGATPRRVPCASCPYRQTVPSGIWHPDEYDKLRRYDGPTHEQSSLNVFHCHQGAGDICSGWLGHRDPADLLAVRVGIASGAVDPSC… |
| G2PHT3 | 4-124 | VRYRLNGPCGDCPWRTDVEPGQFEAYRFDSLKTTSTQPEVTSAADVLGQPMFACHQTQEGREQACAGWLVVAAAQGNLRIRLALATG… |
| A0A0B1MUA6 | 3-114 | None |
| A0A729NV66 | 9-126 | None |
| A0A6P2M2D2 | 2-120 | None |
| A0A291W550 | 37-153 | None |
| A0A4Q9VH65 | 24-140 | None |
| A0A556UVH9 | 1-94 | None |
| A0A6M6E2U0 | 1-109 | None |
| A0A3Q9PBF9 | 9-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.