DPCstruct | MC18735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 112 ± 7 aa |
| Standard deviation of domain lengths | 6.56 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 19.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A363NU94 | 3-104 | TYEIKITANTAENDREIIEKYWELEDGKFVYRPAVLKAQYGLTLTQLGEIIAKNSFCQMSFGACSECGNDISKEMTAQSSFKKIAAQ… |
| A0A3N4N7J2 | 1-112 | MEIKRQYQSDDIKIQAICTDYWAVNDKQEFIYTVTALRQKYELKQNELLNIAKNHSSVIFQAMCFECGAEYIERQIYQRKDYDDILQ… |
| A0A4V6NQL1 | 4-122 | None |
| A0A3M0Y3I1 | 2-115 | None |
| A0A2M7NL18 | 4-125 | None |
| A0A2D9Y4F4 | 3-107 | None |
| A0A1G5DVF6 | 6-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.