DPCstruct | MC18732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 198 ± 20 aa |
| Standard deviation of domain lengths | 19.54 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14751 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5TBP8 | 172-347 | SGFDFDTRQRLMFASYNGWERGLGFCALYDALAPLSATLYDTQRVKFSYGGRDWMFQIWKGFYFGFLTGAELGLYTKPESRPVEFYD… |
| G5IBY0 | 18-228 | AVLIWFIRMRHFKPTRDKRVQQDMLNHDLKETGFAYELRGDYFYSLMDCWQREMGYCRLYDENAHLFNMIMDCEPVTFSYGGKKWLI… |
| A0A0Q7ET28 | 16-211 | None |
| A0A847QQ95 | 57-247 | None |
| A0A1M6Y3P5 | 190-396 | None |
| A0A1Y1V2P5 | 4-174 | None |
| A0A6P1TID6 | 4-167 | None |
| A0A840SCX8 | 22-220 | None |
| A0A7U9R2L9 | 186-407 | None |
| A0A366I3M5 | 896-1105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.