DPCstruct | MC18730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 210 ± 20 aa |
| Standard deviation of domain lengths | 20.24 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 63.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060PXV6 | 90-289 | NTPNNSFLEVFDNAYKNLDREQFKAFKEMFANNSANFHNLNNDIMIKNFTISPYLTDALDTTAKMLESGNRSDNFSKLVHDIDYLIN… |
| J0DDU9 | 1-212 | MFNMPRTKTQGIELLNRWQKEFSNDIKSYEKVKKMFVDNAGSFHNLIHDMNFPNVSLNAYLSDIMDRSFANLKNYQTTSESLKDLSE… |
| J0TTR5 | 43-254 | None |
| A0A1V3BEM7 | 578-780 | None |
| J0GP04 | 405-604 | None |
| A0A2T6TPD9 | 540-750 | None |
| K2KT25 | 35-256 | None |
| J0NZ66 | 228-380 | None |
| F8KP72 | 1-198 | None |
| A0A438YNP2 | 659-875 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.