DPCstruct | MC18729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 117 ± 8 aa |
| Standard deviation of domain lengths | 7.75 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0Q2V4 | 7-114 | LTGCGIGGFWINGDPSAGKNLKPYLEEWEKTGTSPEMRGQASASCGGGDSDRAPLFTTAQIRAEQRPGEKEIFSYYRLHDNWQRCML… |
| A0A495BCK5 | 1-128 | MRRLFILFLLVSLSACTIGNGHICGPQTPIFYCDKEAYDKLLHPKPFVELWHKPAVSSNIRLNDWVSCGGYGDGNFTLQSKKMFPGE… |
| A0A7W8KP91 | 43-153 | None |
| A0A8B5YUW7 | 2-129 | None |
| A0A6S7DN97 | 2-126 | None |
| A0A246HJI8 | 21-136 | None |
| A6SZS1 | 3-111 | None |
| A0A450VPJ3 | 7-116 | None |
| A0A848NNQ3 | 6-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.