DPCstruct | MC18728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 174 ± 13 aa |
| Standard deviation of domain lengths | 12.50 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 15.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U6LC01 | 1-170 | MGYSVGETFMVEFVILNSSSLPFKDKYEFEKNIIEFLKVTNYLSQKLKNYIKIKTFIEIKDMIIYSNKTLKETIYSIKDEVLRRKLF… |
| A0A849UAJ1 | 1-196 | MSNRLIINDASLPFSSDIECNNKLESFFKIIHHADSAGISFNQADEMHGNWNALNYAEGFIFGEWINRIDKTSALIVKNVISKVDCP… |
| A0A212G186 | 1-162 | None |
| A0A6C2DUA3 | 2-162 | None |
| Q027Y8 | 1-169 | None |
| A0A1I1TKF8 | 1-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.