DPCstruct | MC18724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 136 ± 15 aa |
| Standard deviation of domain lengths | 14.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0EJC0 | 7-139 | AKPASSLTPDDLAAHPVWRFLTPGDAAPDGADESWVRAQDAPPRVGEHASYLVAATYRLQSGATLPGAVQVDVLGAQVELDPCVIFA… |
| A0A1F3PMF9 | 2-156 | TPKKTEHLTIADFEQYPIWEYVQTENLEEGLLVVPLQCSSEVFKKRLESIVVFESFYAKTKFITPKGKEFSGYSRISNHTKFFGIQP… |
| A0A538J328 | 5-136 | None |
| A0A5C5ZN59 | 13-169 | None |
| A0A7C1PCE3 | 3-134 | None |
| A0A0N7IF91 | 21-138 | None |
| A0A1N6V717 | 3-129 | None |
| B4DCB3 | 5-153 | None |
| A0A3G6WZW0 | 2-136 | None |
| A0A2S8GKH5 | 20-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.