DPCstruct | MC18720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 5.34 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I5NR18 | 3-67 | LIQTLYALVPQQFNMLIFVLNPPTGIIPPMSAPVGDRASALLAWAEGSEGCGLLELQYSLNKVLK |
| A0A6I5QZV3 | 11-88 | IQRLKLSEVMNSLLSAHFNQVVIALAPPHGIVAPKDAPQSDRAFDLIQWVESPTGPGLETLLEILQHFPSPELEEILT |
| E0UN12 | 5-84 | None |
| A0A1Z3HHW0 | 153-226 | None |
| E0UKG2 | 2-85 | None |
| A0A6L9YWW9 | 16-99 | None |
| A0A6G3Z7E9 | 3-88 | None |
| A0A6G3YWV8 | 4-74 | None |
| A0A6G3Z265 | 5-78 | None |
| A0A6G3Z4N6 | 3-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.