DPCstruct | MC1872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 100 ± 5 aa |
| Standard deviation of domain lengths | 4.59 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 42.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0HXN0 | 17-115 | VIDRRADWDGRHHDVLGPAAATLEERFPLAATVPYRAVINDILKRGKSPAYGQAARYLAVLEALSGLLPTDAPIESHQDCHAALKAS… |
| A0A520FRJ6 | 77-172 | VIARADQLNGDHYGLLTPAANALETRHPLAATLVLRAMIDLSLDAAKYKRYGHAARHLRTCEHLARRIDDFAGHSDHPDYVAELKRR… |
| A0A7W5BLH5 | 227-324 | None |
| A0A7T1HPR9 | 117-218 | None |
| A0A3A4VUW1 | 358-464 | None |
| A0A1B6YQU5 | 54-151 | None |
| A0A235H8X5 | 2-100 | None |
| A0A0K8MBY8 | 62-161 | None |
| A0A0D6PLK5 | 2-98 | None |
| W7QE80 | 34-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.