DPCstruct | MC18719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 138 ± 20 aa |
| Standard deviation of domain lengths | 19.73 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428K4K1 | 92-217 | ISFKDFPADVFKGQLADPDFSTNPDVKSFITRIKNECANGINFAGHYTLVTWGCGSTCQSGVLVDRKTGKIFSGVDTSLGSKFKKDS… |
| A0A435K2N4 | 2-120 | YLKGKSALPKFAGSAAQFKTRIRNGMKSGPNYGGHFTMIEIGCGTSCIFAFLIDGRDGRVVDFPLGGEDNYQLQLRYGIDSTLLQAD… |
| A0A2N2WD84 | 97-242 | None |
| A0A6L3ZF33 | 238-361 | None |
| F8J639 | 13-162 | None |
| A0A2D6IL56 | 141-284 | None |
| A0A1J0ET16 | 4-141 | None |
| A0A3S0QTW6 | 200-332 | None |
| A0A1F6FIN3 | 20-159 | None |
| A0A519T272 | 4-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.