DPCstruct | MC1871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 398 ± 45 aa |
| Standard deviation of domain lengths | 44.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E5Q337 | 2-382 | LWSVSVCDIIYKLQYLVDLYADSAAKEILDEITSLQDSDKKSPAWEIKLLEDIFNKTNLINSPEYENLRYLQQQRHLSAHPVLNHNS… |
| A0A1G0CVK7 | 3-433 | EFSIDLAAEQIADQRTKEYFQEVLGSFINGNYRSAVVMLWSVVVADFVYKLQALRDLYQDPTAISILDSIEAKQQANPTSPEWEPFL… |
| A0A800J4Y3 | 8-413 | None |
| A0A1B2HSF2 | 1-381 | None |
| A0A4R3EUQ9 | 33-476 | None |
| R5D9J2 | 17-349 | None |
| A0A1I0KZ80 | 2-439 | None |
| A0A1G9S043 | 7-373 | None |
| A0A1Y3KZ41 | 2-330 | None |
| S4CBS1 | 1-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.