DPCstruct | MC18709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12069 |
|---|---|
| Mean domain length (aa) | 154 ± 28 aa |
| Standard deviation of domain lengths | 27.61 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.34 |
| Mean intra-cluster sequence similarity (%) | 10.50 |
| Pfam Score | 33.95 |
| Assigned Pfam label(s) | CL0103- CL0219- CL0001- PF01973- CL0045 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A853PKU2 | 229-390 | EGMHIYDQGFNSGTLKHWTISGDASKAEIVKSQGANDMLRIQGNKEKVSLTQKLTGLKPNTKYAVYVGVDNRSNAKASITVNTGEKE… |
| A0A7T3RCY4 | 251-393 | NLVSDSSFETGRLGEWKLNGDSTACFVENNKNNAHSGKWTYKYWKSTGFKSTLTRKITGLSEGTYILSLWAMGGGGENNIRLFAANF… |
| A0A4S2MLX4 | 7-201 | None |
| A0A1S8W315 | 378-529 | None |
| A0A1R0YLB9 | 58-223 | None |
| G8SIY4 | 4-133 | None |
| A0A1Q9C683 | 453-601 | None |
| A0A3L7PBV6 | 698-838 | None |
| A0A1S8VGX2 | 6-157 | None |
| A0A3L7PNC5 | 249-406 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.