DPCstruct | MC18708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 81 ± 11 aa |
| Standard deviation of domain lengths | 11.15 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 63.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M2WZM1 | 1-71 | MSLSNPDQQVIGLAGNPTDTSQPYSQEGNKDLAFMDMKKLAQFLAGKPEHPMTRETLNAENIAKYAFRIVP |
| A0A3M3L6G7 | 35-118 | KDAADHGLEDATHCLFGGELSLGNRGQQVIGLASIPYGQEGDKELVFMDMKKLAQYLAGDPRHPMHRQPLNEGNIASYAFRIVP |
| A0A3M3S780 | 138-210 | None |
| A0A3M5ACU2 | 242-325 | None |
| A0A3D8JU15 | 451-562 | None |
| A0A4P6QP84 | 281-363 | None |
| A0A5H2PWA9 | 33-111 | None |
| A0A3M6C2S1 | 1-62 | None |
| A0A0Q0CM26 | 354-438 | None |
| A0A3M3QMA9 | 20-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.