DPCstruct | MC18705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 111 ± 12 aa |
| Standard deviation of domain lengths | 12.14 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 36.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0763- PF05943 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J5F8I8 | 536-659 | GEEGGGLVDGLPLYQYRTDRGSDVLFCPTEVAITDRREKELSDLGFIALCHCKGSSRAVFFGGQTVNQPIKYLSDEANANAELSARL… |
| A0A0Q2ZBS6 | 1-101 | HLYDLGTGNQVKIPSEVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPVLYDTPDATANSRINARLPYIFLLSRIAHYLK… |
| A0A6A5KZZ0 | 317-418 | None |
| A0A085WCI2 | 657-773 | None |
| A0A812HMJ5 | 318-441 | None |
| A0A2E9YDE7 | 371-469 | None |
| A0A7S6S1K3 | 342-436 | None |
| A0A4S4AYK5 | 455-580 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.