DPCstruct | MC18702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 54 ± 4 aa |
| Standard deviation of domain lengths | 4.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 48.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2SFW2 | 1-46 | MIEASEFPELSRRYGVYGVPKTIINETEEVEGAVPESVFLEAVLRA |
| A0A7V3XM99 | 1-60 | MAVASDRVRATAIEATEFPEMSRTYRVMAVPKVVINDRVQFEGALPEKEFLAAVLQAAAA |
| A0A7J2MZA2 | 1-51 | None |
| A0A1F5RNP5 | 7-65 | None |
| A0A7C7L056 | 12-68 | None |
| A0A0T6AKL4 | 3-55 | None |
| A0A7V0SFK3 | 8-62 | None |
| A0A1F8QTE5 | 1-59 | None |
| A0A2H5YAM8 | 15-65 | None |
| A0A2V7DT50 | 14-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.