DPCstruct | MC1870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 461 ± 113 aa |
| Standard deviation of domain lengths | 113.21 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 89.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0C2B6 | 503-952 | NYTLLAWNNLGMHCYDGNDYSIFAILPPLNTVNAQLVNQASGGLVTSGVTLTYQATADTTGSVNSISSTKTNFWDYVQDLFGLAPAP… |
| F3YYX9 | 48-494 | EPAPYVIKELPTTIPAFDAEQSEYVLLAWNNLGMHCISDSDPWWILLPPANDLHAQLVRRGPSPEIVTEGVELTYRVESGFETPSAH… |
| A0A7T0JSH7 | 158-698 | None |
| A0A3D0DCD6 | 33-378 | None |
| A0A1V5ZFC9 | 190-553 | None |
| A0A3M1EE75 | 1-386 | None |
| J1FBA4 | 39-499 | None |
| A0A7V7MKY2 | 39-571 | None |
| A0A5K7ZE98 | 263-685 | None |
| A0A388SKQ3 | 63-517 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.