DPCstruct | MC187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 134 ± 16 aa |
| Standard deviation of domain lengths | 16.06 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15656 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832DYI3 | 15-121 | KHGGVLSSSPNSAGGTVVTSTGKISQNDIAPYVNSGLYKGDVNIISGAHGSPNQMIPDAGMFKADVARFGNIPGVKVHDITKMKSSE… |
| A0A285DP51 | 164-283 | YKPQDHNPVVSWQEGSNAAGGRVFTSNKVIAQNDFVSIVNDARKRGDDIHILTGAHGSSDGIMTAERRFYAEDISRFGDFPGVTVHH… |
| W1J1U1 | 80-222 | None |
| A0A1X7D1K3 | 146-272 | None |
| T0NT22 | 83-245 | None |
| A0A4R4G322 | 599-743 | None |
| A0A0U4BEI2 | 296-405 | None |
| A0A1D3TZE1 | 101-215 | None |
| Q9S6J0 | 8-150 | None |
| A0A3A9VVK0 | 2-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.