DPCstruct | MC18699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 534 ± 140 aa |
| Standard deviation of domain lengths | 140.14 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 90.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2NMW1 | 183-691 | DHHEMGTNATFFFQPGIPSRTHPLTPKLNQELTGEIGKFHAKALNKIGSLYYTEESFDDFYYGKGSTFPDINGGIGILFEQASSRGH… |
| A0A7V2MY95 | 2-517 | DFHEMDYNSTYFFFPAAPPINPLYPPHILAWGRRFGAGNAAAFDARGWAYYTGEAFDLFYPGYGDSWPSLLGAVGMTYEQAGHGAAG… |
| A0A090VYS8 | 184-477 | None |
| D0LWN9 | 328-1043 | None |
| A0A345NQK7 | 248-738 | None |
| A0A3L7UVH3 | 252-892 | None |
| A0A831SZR9 | 13-558 | None |
| A0A1H9N9T6 | 350-941 | None |
| A0A3G1KUI0 | 67-880 | None |
| A0A7G9F6D4 | 238-885 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.