DPCstruct | MC18697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 6.66 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A561SDX5 | 1-103 | MAGEFVLEADGDMLRFFARIADEMVERLGIDRAEAVARINDAWAEVEFEPYPDLVCHEPPGYWALELYYDEVRSWSPLADRSDWEAR… |
| A0A4S4BWN5 | 1-92 | MIEFKFKTSSKVREYCEAIIQEMMSQFNITFEEGVDRINQKWGHFKVKTDEDDMIFHMLPVEWAKIIYYGADARWWDKNEKLTPAPY… |
| A0A6N9PY30 | 73-162 | None |
| A0A7W7MJ99 | 2-88 | None |
| A0A516NVX3 | 4-86 | None |
| A0A6M1L1G1 | 17-111 | None |
| A0A4R6SDD9 | 117-204 | None |
| A0A4U0RE35 | 35-138 | None |
| A0A1H6D0K7 | 1-87 | None |
| A0A1F5LW35 | 27-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.