DPCstruct | MC18694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 110 ± 10 aa |
| Standard deviation of domain lengths | 9.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 95.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1FYJ8 | 380-485 | SPFDGTGIGRPWPLLTGERAHYEIVAGNYSYAAQLLKTMENYANEDGMMPEQVWDSEDIPELELFFGKPSGSAMPLAWAHAEYIKLC… |
| A0A2V9SH26 | 77-176 | GTGVGRCWPILTGERGHYELAAGRDPLPFIKSLENFANQGGMISEQLWDAEDLQNGNMKRGSATGAAMPLCWSHAEYISLVRSRHDG… |
| A0A1Q7CCN9 | 81-195 | None |
| A0A356ZZA0 | 13-126 | None |
| A0A7Y0L8D0 | 196-325 | None |
| A0A537DZD5 | 145-257 | None |
| A0A1Q7WS33 | 2-96 | None |
| A0A838J4Q6 | 150-257 | None |
| A0A1L9B8M7 | 3-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.