DPCstruct | MC18691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 165 ± 11 aa |
| Standard deviation of domain lengths | 10.90 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9SVF3 | 2-159 | EVMICVSANKFLVQQYKEGRLSTDSINKLTKAWGSKNRPQVLEFQFDQATQRDLILANIRTLRFNGETSTNPVLLNSNLHNWKAIVK… |
| S8BCM6 | 756-929 | PASLVTSLDSTIQAKLYAELEVLICNTANQFILEQYYGGRISQHSIDKVNAAWNAKNQHHVNEFRFDQATQRELIVANRRQIEFTGD… |
| A0A842Z1E8 | 24-202 | None |
| A0A0N1NZ08 | 824-988 | None |
| A0A162I2G9 | 858-1023 | None |
| N1JNP2 | 269-421 | None |
| A0A0F2MGU4 | 165-317 | None |
| A0A0D2IRM9 | 150-340 | None |
| A0A2J6TQF3 | 134-292 | None |
| A0A084AGK2 | 411-593 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.