DPCstruct | MC18690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 6.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 66.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9STS0 | 1-70 | MRFSLAAIAALVTSVVATSYTTEIVTNYVTYCPESTTIIHGTETYSVTAPTSLTMSGGPYTISRPLMTST |
| A0A1E1KKF4 | 1-82 | MQLTTALLVVAAIAPVFGHIAAGTTGMVNATVTASVTRTVTAYETFCPDPTTFTEGTKTYTATAEEWITVKECPHKCTITYD |
| A0A218ZEX3 | 206-278 | None |
| M2MHI2 | 1-74 | None |
| A0A4Q4THB3 | 246-332 | None |
| J3P4N1 | 50-127 | None |
| J3NHQ5 | 4-79 | None |
| A0A0A1T6V4 | 605-665 | None |
| J8TYA6 | 14-107 | None |
| A0A4V6WKA5 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.