DPCstruct | MC1869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 127 ± 18 aa |
| Standard deviation of domain lengths | 17.59 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519PHQ4 | 53-190 | DSISGYIVKLDKQKKSVERKIMTGRYNEALSSLNEINIKKERQLLFNTFDEVFISIFPNFINVLNSMLSPQDQIWPKQPELLNTELR… |
| A0A4Q0UAU4 | 4-117 | VGKYDDLLASLKSKAQIDAEMDTFYEAFDRMFLSIYPDFVSQISAMIENPSKPRRSSLSTEMRIIALMKLGIEDTDDISAMLRYSPR… |
| A0A250KPC2 | 23-160 | None |
| A0A7J0ARR4 | 234-375 | None |
| A0A520A2D3 | 83-220 | None |
| A0A3N2LAZ2 | 162-269 | None |
| A0A4S2G6X4 | 70-209 | None |
| A0A553F972 | 24-139 | None |
| A0A4Q3DZV9 | 34-173 | None |
| A0A4R2LUT6 | 66-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.