DPCstruct | MC18685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 142 ± 17 aa |
| Standard deviation of domain lengths | 16.51 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 67.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.91 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 35.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07896 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9SJ50 | 1-151 | MSFALRRTLLSSPLFRSSRSLSTTSSLRNAADDKPSPFASAPAPPRLPKEEQEIFERLQRQSTGAFSTPNTEGAESSEDRLAAMRAQ… |
| A0A642VCD2 | 1-130 | MFLRRVVSAGAQIRVPKMMIAGQRPYSSLFKEGPAPPKLSKEDQEEFERLQRTANSELALEMTPEDLEALQKGEVSMEEKNKSLGLH… |
| A0A4U0W4C3 | 30-168 | None |
| A0A167PZF6 | 45-172 | None |
| A0A180GTN6 | 3-120 | None |
| A0A060SJ85 | 83-210 | None |
| A6R2E4 | 1-159 | None |
| A0A2H3J4A4 | 80-231 | None |
| A0A553HT41 | 123-279 | None |
| A0A1D2JKI6 | 1-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.