DPCstruct | MC18682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 170 ± 15 aa |
| Standard deviation of domain lengths | 15.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397T745 | 39-198 | SSKFALETVGNVGEAVGPYLPLITAVTTLTAQIVKAYENAQYNKKSCAALIERVQASEVAVQALNRRKQENEKKFRKQTYYISFEKF… |
| A0A397HKB7 | 4-185 | FNLIQTVGMVVVPFLPLFTAITKIVESLNLTRKNAKYNERICNALLDRVEIIQHAVKSLLRKHKENAENFREQNYYHAWVRLIDVLT… |
| A0A2I1DWU4 | 333-497 | None |
| U9U4U9 | 8-211 | None |
| A0A2N1NZD2 | 14-149 | None |
| A0A2N1NJX2 | 15-176 | None |
| A0A2N1NAN1 | 9-182 | None |
| A0A397IQ43 | 14-184 | None |
| A0A2I1EIQ3 | 428-596 | None |
| A0A397VAW9 | 12-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.