DPCstruct | MC18680
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 143 ± 14 aa |
| Standard deviation of domain lengths | 14.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397TWJ1 | 8-143 | STYQRPKAEKLDCIFADLVNRYKAIHLRACGTSELQTWQHADSPNVAMNLLKYHTYISKLVEHHTSLATYSICQTHYNQVINTNQFY… |
| A0A397GWS9 | 5-168 | SSVSRPYPKELPCLFVDLFASYKQKGLIECGTKEAQVWQYANSQKAVSRLFLYNNFFPKLVLRKTSLELYSFCERHYNQIIAKNNFY… |
| A0A397J8I5 | 39-186 | None |
| A0A397IKF1 | 87-255 | None |
| A0A2Z6R5L6 | 3-145 | None |
| A0A397U3H3 | 4-152 | None |
| A0A397U1P6 | 6-170 | None |
| A0A397VCH2 | 29-165 | None |
| A0A397V0D9 | 4-151 | None |
| A0A397W6M5 | 3-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.