DPCstruct | MC1868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 70 ± 2 aa |
| Standard deviation of domain lengths | 2.23 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 82.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 42.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379PJ55 | 13-82 | NTPCKHCGSLDQSWATNIVSPGEVQNGRLRLSDVACQFVLGCNRCSETLMVLSADRVAGLMNRALDEQGK |
| A0A4Q8L4M3 | 3-71 | IIPNICSNCGSDDLAWTPYLRNASGVVDGRLRMHDVSAGFAYSCNECSETLLVATGEEVADFLNTPQAA |
| A0A023WZD4 | 7-72 | None |
| A0A1G4UE99 | 150-222 | None |
| A0A3M4JVH0 | 3-76 | None |
| A0A2Z6AAY7 | 153-222 | None |
| A0A6V7FKK0 | 80-149 | None |
| A0A5F1BVD4 | 10-77 | None |
| A0A4R1W4M5 | 139-209 | None |
| A0A210W7S8 | 2-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.