DPCstruct | MC18677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 136 ± 13 aa |
| Standard deviation of domain lengths | 13.48 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U9UFA6 | 1-146 | MTLRCCLCQETFISRKLLLTHERTKHRNNKTIPHFHLLLRPSFEQLISYQDAFIILIKKRLGFNRHSVGTKRVLINVFPENVFVYLF… |
| A0A397GMZ9 | 4-144 | PIFTCSLCEKKKTYKSHGGLQRHETLKHYNYNIPPSHILSVPEHELSHLKKVMVREVGKRLKNHHSAVGKQVFSIHCSEHAFVGIFG… |
| A0A2H5RB45 | 30-177 | None |
| A0A2H5REJ8 | 5-167 | None |
| A0A397TQP9 | 1-111 | None |
| A0A397U1I6 | 14-123 | None |
| A0A397U7S4 | 42-173 | None |
| A0A397JS24 | 192-318 | None |
| A0A2I1EV26 | 1-132 | None |
| A0A2I1ETN9 | 376-528 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.