DPCstruct | MC18676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 205 ± 32 aa |
| Standard deviation of domain lengths | 32.16 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0NUN4 | 2-234 | KKEHQEVIDQVMKKRVNRICNFELGNLKKETLRLQNELKQEKSKVAGMKRKIDNLEDHVRRIEEENSMLRDFNEIFSNESNELSIFT… |
| A0A397GL04 | 37-224 | STIPETVDKLKTENRKLKEEIAELKRQNSQMEIDFEEKLEKSQENINQMKEEIDFLANINQQFGDSGTESEIIPSKHPKGRKLKSKK… |
| A0A397IR10 | 63-256 | None |
| A0A397IS33 | 1-242 | None |
| A0A397IVW8 | 2-268 | None |
| A0A015JV91 | 1-169 | None |
| A0A397J4R3 | 49-260 | None |
| A0A2N1NN50 | 30-207 | None |
| A0A397IPE3 | 3-183 | None |
| A0A397J2M9 | 71-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.