DPCstruct | MC1867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 119 ± 21 aa |
| Standard deviation of domain lengths | 21.24 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8YI58 | 1-137 | MSEPKENEIFIHPEYDELGLPYYNVPNARIEENLVATCLKYATKVIPVIFLPGVTGSNLKSTEGESVWRLNRILSFDVLVWMCRGAS… |
| A0A081RZN3 | 1-118 | MDKPIEKEEEKEIYLHPEYDECGRPYYNLPNARKEENLIAVCLKYASKVIPVIFLPGVMGSNLKSKHDDEPVWLVNSQLGVAGWISK… |
| A0A2M9E4J8 | 2-119 | None |
| A0A3E0EFS1 | 1-173 | None |
| A0A0Q5PA93 | 1-103 | None |
| A0A1I2JPF5 | 32-153 | None |
| A0A379FZA7 | 1-123 | None |
| A0A7H8UBC2 | 10-99 | None |
| D8ITR5 | 3-152 | None |
| A0A1H9GLS7 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.