DPCstruct | MC18668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 110 ± 14 aa |
| Standard deviation of domain lengths | 14.31 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HRZ7 | 16-119 | FKIFASLLWIFDAILCTLVIRKVPYTEIDWSTYIQQVSCYERGIRNYSKIEGDTGPIVYPAGHIWFYLILSRITNAGKDIRTAQYIF… |
| A0A5D2MYW7 | 2-103 | ALALLIIDSLLVSFIIVYVPYTKIDWDAHMSQVSGFLGGERDYKNLKGDTGPLVYPAGFLYVYSAIQYVTGGQVFPAQILFGILYII… |
| A0A182FGE1 | 44-150 | None |
| A0A2N1JEJ9 | 10-138 | None |
| A0A3S3NTY3 | 40-158 | None |
| L8GSJ7 | 117-198 | None |
| L0PAG2 | 720-801 | None |
| A0A498LAF2 | 34-144 | None |
| A0A1D2NJD4 | 53-161 | None |
| A0A5N4A2J3 | 546-668 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.