DPCstruct | MC1866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 160 ± 20 aa |
| Standard deviation of domain lengths | 20.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A081RQM4 | 3-146 | DRNDHNLKKIIALSLATGAGYFSYSPEIGFNRYKFSEEAILVTNKEIDLYRTCSRDDGWDSGVENICWGIVIQKKTKANKNDYILSD… |
| A0A855PP89 | 17-222 | CIPRDLKVNETNAEYLVRKFGELESKLETALRECRSAGITIDNLDAKCAALAAESAVMKAGHSYFSYGSEHNFEWHKTAEEAIESAE… |
| A0A368AM76 | 13-168 | None |
| A0A1X1D6W9 | 49-217 | None |
| A0A2V3Q0S0 | 30-189 | None |
| A0A849JKR9 | 41-192 | None |
| A8GLP3 | 92-267 | None |
| A0A7X5FZ82 | 17-160 | None |
| A0A454JKU2 | 202-330 | None |
| A0A4Q9D6V7 | 6-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.