DPCstruct | MC18658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 155 ± 10 aa |
| Standard deviation of domain lengths | 9.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0484 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7SP06 | 23-165 | MLNVGSCIWSMRRSKANFFIIVFLFSGMISMSRRLGEVCQWKNPVTSALVHVVFSILICYPELILPTIFLYMFLVGIWNYQFRPRHP… |
| A0A5D2XLU8 | 21-185 | HTLSSRLRRAEPPLQSEVVEYMLDVGSNVWSLRRGRANLERLLAAFNLLVEAWKWFDQIRKWKNPISTMAVHFLYSMLILFPDMILP… |
| A0A1R3KP62 | 1-157 | None |
| A0A7J6W3L5 | 85-234 | None |
| A0A446KXV1 | 1-166 | None |
| A0A2P5XBX0 | 637-798 | None |
| A0A6A6LCK4 | 797-939 | None |
| A0A0A8Y3H9 | 1-145 | None |
| A0A804KUV7 | 226-389 | None |
| A0A2G2YXM2 | 3-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.