DPCstruct | MC18657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 10.64 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7TZJ2 | 1-92 | MSSQQTAEDSKDMTIPNAEEKFIDPIQSKESWQKLMSKRVPPKCEHGEECTSFVTKKAGANKGRSFYTCARPLGPSGDKERGTEWRC… |
| D7SNZ3 | 1-103 | MGDDESKSSKMVELDVSASNQEQGVVISGSSPQRDKNDIALVEWQRIQQLMQNSIPLCKGHGEPCVSRLAKKPGPNHGRRFYVCARA… |
| A0A2C5ZM01 | 195-300 | None |
| A0A1I8HY20 | 226-329 | None |
| B7ZA71 | 236-346 | None |
| A0A2G8L4S9 | 283-388 | None |
| C4JE29 | 393-491 | None |
| A0A7S3LM83 | 36-131 | None |
| A0A7J6X9Q2 | 152-267 | None |
| A0A4Y7I7G9 | 246-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.