DPCstruct | MC18655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 113 ± 15 aa |
| Standard deviation of domain lengths | 15.02 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 65.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07797 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C4J8A0 | 2-105 | DGVYHHHHHQESPLTGNGVATAGEKLGVERFELPLIYISLSRKEKEDDFLAMKGTKLPQRPKKRAKNVDKTLQFVFPGMWLSDLTRG… |
| D7SJ15 | 19-110 | DSERPWNLRTRKAACKVPCEAAVVEKKKKRERPKFSVSLSREEVRDDFMAMVGTRPPRRPKKRARIVQKQLDSIFPGLWLTEITLDT… |
| A0A835RPH8 | 112-226 | None |
| M1A5V3 | 2-136 | None |
| A0A0E0HHZ2 | 303-402 | None |
| A0A6A6LFP9 | 1-98 | None |
| A0A443NUQ0 | 139-261 | None |
| A0A6P4ATP7 | 182-298 | None |
| A0A540KB34 | 137-226 | None |
| A0A835SAT8 | 60-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.