DPCstruct | MC18653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 214 ± 33 aa |
| Standard deviation of domain lengths | 33.24 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A5CBF7 | 37-239 | AVAGRIFNILPRDPFPSGPGSSTEEIRELQELQRTLYTFLHVIATHDLSSVFLSPRSRGYLDPMMQLLLRTACGHKDTLVRKACVQI… |
| A0A0A9FR08 | 8-168 | TILLAPSCRQYLETIMQLLLFTSCSHKDILLRKACVQIFVKLIKDWCTNSEDKLPGFRVFMIEKFATGCCLYSVLDKSFDLRDANTL… |
| A0A1S3QNC7 | 13-196 | None |
| A0A0P0X927 | 65-265 | None |
| A0A3M7S5Z7 | 4-258 | None |
| A0A7S3LP01 | 35-347 | None |
| A0A080WQ75 | 251-484 | None |
| A0A7S3B7W3 | 21-234 | None |
| A0A7J7ZA88 | 118-343 | None |
| A0A2S7PFW8 | 24-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.