DPCstruct | MC18650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 127 ± 7 aa |
| Standard deviation of domain lengths | 7.34 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R6UW86 | 122-245 | FATFTAPSFGAVHRGPAKDGKTRVCHPRRSGTSCARYHRADDPLIGAPLDPDAYDYARQVMWNNHAGELWRRFTVYLRRHLAAAVGM… |
| A0A401VTJ8 | 59-182 | RVFVTLTPPSFGPVHNRPTTPGSDIRPCRCRKLHEPTEILLGTPLNPATYDYAGAVLFNAHTGALWARFTTYLRREIAAQLGMTQKA… |
| A0A7W7WZ65 | 103-218 | None |
| A0A7K3E9B6 | 3-121 | None |
| A0A4U3MLZ5 | 1-131 | None |
| A0A7I8A777 | 115-252 | None |
| A0A7W5ADD2 | 75-201 | None |
| A0A7W3LXF2 | 116-251 | None |
| A0A3R9WSB2 | 266-386 | None |
| A0A4D4L8Q9 | 20-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.