DPCstruct | MC1865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 121 |
|---|---|
| Mean domain length (aa) | 147 ± 33 aa |
| Standard deviation of domain lengths | 33.30 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 25.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0QV42 | 2-143 | CHKNEKQGQQLGIWAKSTHAKAYKTLLTDEANKIATEKGFTTKAVETEACLKCHASGYNVDASLLDAKFTIEDGVQCETCHGPGSEY… |
| A0A432SDH4 | 12-143 | SGDYRFVGNTKCRLCHRKFFIGRKKDPHDYAMDHLTGEDETNPRCLICHATGYGVPTGFINRERTPRLANVQCEGCHGPGNVHIKLA… |
| A0A7V2U9A8 | 434-534 | None |
| A0A2E8Q498 | 24-235 | None |
| A0A3N5WLV9 | 202-327 | None |
| A0A3M1E384 | 128-319 | None |
| A0A3D1R5V6 | 31-178 | None |
| A0A7Y4QR07 | 24-192 | None |
| A0A7X3WI93 | 304-430 | None |
| A0A3A0CH86 | 234-403 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.