DPCstruct | MC18648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 110 ± 4 aa |
| Standard deviation of domain lengths | 4.42 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R6ZXX2 | 2-103 | HALRLAGVDFSVPEADLRDWLSNPSFTPYPAITGALIKMLGGKQLRRSVFIDVIVFNYEHAPGASSPRRMADVDLDLLAKAIVKGHN… |
| A0A1I4V5M7 | 7-114 | PEATIRALDGVGVDFSIPKSALTDFLGNAEFTPYPALSAGLLSLLDGRMLQRPVFLDVIVFNYEHSPGDPSPRRLEDVVFEVLKAAI… |
| E3IWN8 | 316-420 | None |
| A0A1H5EYR5 | 418-529 | None |
| A0A437LXZ6 | 509-626 | None |
| A0A0B2YW87 | 7-114 | None |
| A0A559TW12 | 15-122 | None |
| A0A7H8J116 | 604-710 | None |
| A0A2T2ZH22 | 754-862 | None |
| A0A1H5KCP1 | 363-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.