DPCstruct | MC18641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 7.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 42.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J0PDL6 | 1-76 | MVNDSKAEDLEAKGLYRRAAARWMEVMLLCTEDDDREWIKRRRETCLENVKRPPVKVEDFGDLHKAVTETQHRMGI |
| A0A806NQ19 | 1-90 | MVSDSKAEALEAKGLYRRAATRWMDVMWCCTEDDDRDWVRQRRDDCLQKARRPPARPESYHGLSEAATQTQNRMGIGQPNGQAFRLK… |
| A0A7Z1PMB4 | 1-87 | None |
| B7MV60 | 41-118 | None |
| A0A8B2WCE2 | 1-90 | None |
| A0A336QW53 | 1-102 | None |
| A0A822P2L4 | 3-85 | None |
| Q49JF3 | 30-106 | None |
| A0A5V5CS95 | 29-116 | None |
| A0A0D8W4F7 | 10-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.