DPCstruct | MC1864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 131 ± 14 aa |
| Standard deviation of domain lengths | 13.52 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12089 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q4AS20 | 16-134 | VAVKQVRLKLVYVDFWSAVKLSFLVATSLGIVLIVASILVWIVLNSTGIFGSLNDILVDVLGDPKFSVTGTFSLGTVALFSFIIAIL… |
| A0A1R4J7B6 | 81-217 | TADVPGAASAGINRRTRKARLRLSRLDPWSVMKTMLLFSVAGGIIFFIATWVVWGVINTSGVFDSVNKSVTDLVASPGSETAFRLED… |
| A0A2E5P097 | 110-231 | None |
| A0A367HL83 | 69-210 | None |
| A0A661BJV6 | 2-110 | None |
| A0A2M7APN4 | 1-169 | None |
| A0A286EJX5 | 124-241 | None |
| A0A4R8XV74 | 18-146 | None |
| A0A6I1PED8 | 1-109 | None |
| A0A7W0P5M2 | 174-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.