DPCstruct | MC18639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 44.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00696 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379D783 | 1-72 | MGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDMLRALLDNHIVPVINENDARRHQRNQGRRQ |
| A0A6B2LLT7 | 94-164 | RACAAAGQSGMMSLYDDMFSQKGVAISQILLTENDFRNPQVRKHLQDTLNVLLKWNVVPIINENDVITTRT |
| A0A2S5TMC6 | 55-119 | None |
| H3H1G1 | 29-101 | None |
| T2JZE0 | 1-65 | None |
| X0PGW2 | 20-80 | None |
| A0A0A9D2K8 | 6-76 | None |
| A0A177VRG1 | 25-89 | None |
| A0A099DAX8 | 12-85 | None |
| A0A142G094 | 21-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.